| Catalog Code: | H00006736-B01 |
| Product Type: | Primary Antibody |
| Product Name: | SRY Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 6736 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SRY - sex determining region Y, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. |
| Alternate Names: | anti-TDF antibody, anti-TDY antibody |
| Immunogen: | SRY (-, 1 a.a. ~ 204 a.a) full-length human protein. |
| Epitope: | MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |