ExactAntigen

SRY Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006736-B01
Product Type:Primary Antibody
Product Name:SRY Antibody
List Price:295
Clonality:Polyclonal
Gene ID:6736
Host:Mouse
Product Description:Mouse Polyclonal anti-SRY - sex determining region Y, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Alternate Names:anti-TDF antibody, anti-TDY antibody
Immunogen:SRY (-, 1 a.a. ~ 204 a.a) full-length human protein.
Epitope:MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human SRY antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about