| request information: |
|
| Catalog Code: | H00006733-B01 |
| Product Name: | SRPK2 Antibody |
| Product Description: | Mouse Polyclonal anti-SRPK2 - SFRS protein kinase 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6733 |
| Gene Symbol: | SRPK2 |
| Immunogen: | SRPK2 (1 a.a. ~ 699 a.a) full-length human protein. |
| Epitope: | MSSRKVLAIQARKRRPKREKHPKKPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGY
HPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQ
LIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDD
AYVRRMAAEATEWQKAGA |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for ELISA and Immunofluoresence. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot, |
| Species Summary: | Hu |
| Alternate Names: | anti-SFRSK2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |