| request information: |
|
| Catalog Code: | H00006732-M01 |
| Product Name: | SRPK1 Antibody |
| Product Description: | Mouse Monoclonal anti-SRPK1 (6H5) |
| Clone: | 6H5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6732 |
| Gene Symbol: | SRPK1 |
| Omim ID: | 601939 |
| Immunogen: | SRPK1 (AAH38292, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. |
| Epitope: | NETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETD SCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIP CEDEQEQEHNGPLDNK |
| Specificity: | SRPK1 - SFRS protein kinase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a serine/arginine protein kinase specific for the SR (serine/arginine-rich domain) family of splicing factors. The protein localizes to the nucleus and the cytoplasm. It is thought to play a role in regulation of both constitutive and alternative splicing by regulating intracellular localization of splicing factors. A second alternatively spliced transcript variant for this gene has been described, but its full length nature has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Serine/arginine-rich protein-specific kinase 1 antibody, anti-Serine/threonine-protein kinase SRPK1 antibody, anti-SFRS protein kinase 1 antibody, anti-SR protein kinase 1 antibody, anti-SR-protein-specific kinase 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |