| request information: |
|
| Catalog Code: | H00006732-B01 |
| Product Name: | SRPK1 Antibody |
| Product Description: | Mouse Polyclonal anti-SRPK1 - SFRS protein kinase 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6732 |
| Gene Symbol: | SRPK1 |
| Immunogen: | SRPK1 (1 a.a. ~ 655 a.a) full-length human protein. |
| Epitope: | MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGR
YHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNG
THICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRITHTDIKPENILLSVNEQYIRRLAAEATE
WQRSGAPPPSGSAVSTAP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | This gene encodes a serine/arginine protein kinase specific for the SR (serine/arginine-rich domain) family of splicing factors. The protein localizes to the nucleus and the cytoplasm. It is thought to play a role in regulation of both constitutive and alternative splicing by regulating intracellular localization of splicing factors. A second alternatively spliced transcript variant for this gene has been described, but its full length nature has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-SFRSK1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |