| request information: |
|
| Catalog Code: | H00006721-A01 |
| Product Name: | SREBF2 Antibody |
| Product Description: | Mouse Polyclonal anti-SREBF2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6721 |
| Gene Symbol: | SREBF2 |
| Omim ID: | 600481 |
| Immunogen: | SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. |
| Epitope: | QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTS
AITVAISWLQGDDAAVRSHFT |
| Specificity: | SREBF2 - sterol regulatory element binding transcription factor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SREBP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |