ExactAntigen

SREBF1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006720-M03
Product Name:SREBF1 Antibody
Product Description:Mouse Monoclonal anti-SREBF1 (4G4)
Clone:4G4
Clonality:Monoclonal
ListPrice:295
Gene ID:6720
Gene Symbol:SREBF1
Omim ID:184756,
Immunogen:SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
Epitope:VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASL
TAVVIHWLRRDEEAAERLCPL
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-SREBP1 antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human SREBF1 antibodies


2008©ExactAntigen home | browse | about