| request information: |
|
| Catalog Code: | H00006712-A01 |
| Product Name: | spectrin, beta, non-erythrocytic 2 Antibody |
| Product Description: | Mouse Polyclonal anti-spectrin, beta, non-erythrocytic 2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6712 |
| Gene Symbol: | SPTBN2 |
| Omim ID: | 604985, |
| Immunogen: | SPTBN2 (NP_008877, 643 a.a. ~ 721 a.a) partial recombinant protein with GST tag. |
| Epitope: | LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA* |
| Specificity: | spectrin, beta, non-erythrocytic 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera<br>Other applications have not been tested. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |