| request information: |
|
| Catalog Code: | H00006697-A01 |
| Product Name: | SPR Antibody |
| Product Description: | Mouse Polyclonal anti-SPR |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6697 |
| Gene Symbol: | SPR |
| Omim ID: | 182125, |
| Immunogen: | SPR (NP_003115, 164 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Epitope: | FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLL
SLLEKDEFKSGAHVDFYD* |
| Specificity: | SPR - sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |