| request information: |
|
| Catalog Code: | H00006696-M12 |
| Product Name: | SPP1 Antibody |
| Product Description: | Mouse Monoclonal anti-SPP1 (3G11) |
| Clone: | 3G11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6696 |
| Gene Symbol: | SPP1 |
| Omim ID: | 166490, |
| Immunogen: | SPP1 (NP_000573, 148 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
| Epitope: | SVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH
KQSRLYKRKANDESNEHSDVIDSQELSKVSR* |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | protein A purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-Osteopontin antibody, anti-secreted phosphoprotein 1 (osteopontin antibody, anti-bone sialoprotein I antibody, anti-early T-lymphocyte activation 1) antibody, anti-HGNC:11255 antibody, anti-BNSP antibody, anti-BSPI antibody, anti-ETA-1 antibody, anti-MGC110940 antibody, anti-OPN antibody, anti-Secreted phosphoprotein-1 (osteopontin antibody, anti-bone sialoprotein) antibody, anti-secreted phosphoprotein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|