| request information: |
|
| Catalog Code: | H00006696-M09 |
| Product Name: | SPP1 Antibody |
| Product Description: | Mouse Monoclonal anti-SPP1 (3E11) |
| Clone: | 3E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6696 |
| Gene Symbol: | SPP1 |
| Omim ID: | 166490, |
| Immunogen: | SPP1 (AAH07016, 1 a.a. ~ 301 a.a) full length recombinant protein with GST tag. |
| Epitope: | MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDD
DDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSK
KFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKAN
DESNEHSDVIDSQELSKV |
| Specificity: | SPP1 - secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Osteopontin antibody, anti-secreted phosphoprotein 1 (osteopontin antibody, anti-bone sialoprotein I antibody, anti-early T-lymphocyte activation 1) antibody, anti-HGNC:11255 antibody, anti-BNSP antibody, anti-BSPI antibody, anti-ETA-1 antibody, anti-MGC110940 antibody, anti-OPN antibody, anti-Secreted phosphoprotein-1 (osteopontin antibody, anti-bone sialoprotein) antibody, anti-secreted phosphoprotein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |