| request information: |
|
| Catalog Code: | H00006690-M01 |
| Product Name: | SPINK1 Antibody |
| Product Description: | Mouse Monoclonal anti-SPINK1 (4D4) |
| Clone: | 4D4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6690 |
| Gene Symbol: | SPINK1 |
| Omim ID: | 167790, 167800, 608189, |
| Immunogen: | SPINK1 (AAH25790, 24 a.a. ~ 80 a.a) partial recombinant protein with GST tag. |
| Epitope: | DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR KRQTSILIQKSGPC* |
| Specificity: | SPINK1 - serine protease inhibitor, Kazal type 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Localization: | Secreted |
| Background: | SPINK1 (Serine protease inhibitor, Kazal type I) is a trypsin inhibitor which is secreted from pancreatic acinar cells into pancreatic juice. It prevents the trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Pancreatic secretory trypsin inhibitor antibody, anti-PCTT antibody, anti-PSTI antibody, anti-Serine peptidase inhibitor Kazal type 1 antibody, anti-Serine protease inhibitor Kazal type 1 antibody, anti-SPINK 1 antibody, anti-Spink 3 antibody, anti-Spink3 antibody, anti-TATI antibody, anti-Tumor associated trypsin inhibitor antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
| Product References: | 1. Tomlins SA, Rhodes DR, Yu J, et al. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Cancer Cell. 2008 Jun;13(6):519-28. |
order or
more information: | company product webpage |