ExactAntigen

Mouse Monoclonal anti-SPAST (3A12)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00006683-M01
ProductName:SPAST Antibody
Product Description:Mouse Monoclonal anti-SPAST (3A12)
Clone:3A12
Clonality:Monoclonal
Immunogen:SPAST (NP_055761, 200 a.a. ~ 305 a.a) partial recombinant protein with GST tag.
Epitope:PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP* ...
Specificity:SPAST - spastin
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ADPSP antibody, anti-FSP2 antibody, anti-KIAA1083 antibody, anti-SPG4 antibody
ProteinTarget:SPAST - spastin
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:6683
Gene_Symbol:SPAST
see all human SPAST antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about