ExactAntigen

SP3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006670-M08
Product Name:SP3 Antibody
Product Description:Mouse Monoclonal anti-SP3 (2F6)
Clone:2F6
Clonality:Monoclonal
ListPrice:295
Gene ID:6670
Gene Symbol:SP3
Omim ID:601804,
Immunogen:SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag.
Epitope:TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHS
SDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-DKFZp686O1631 antibody, anti-SPR-2 antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human SP3 antibodies


2008©ExactAntigen home | browse | about