| request information: | |
| Catalog Code: | H00006670-M05 |
| Product Name: | SP3 Antibody |
| Product Description: | Mouse Monoclonal anti-SP3 (3H7) |
| Clone: | 3H7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6670 |
| Gene Symbol: | SP3 |
| Omim ID: | 601804, |
| Immunogen: | SP3 (NP_003102, 516 a.a. ~ 616 a.a) partial recombinant protein with GST tag. |
| Epitope: | GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKR LRRVACTCPNCKEGGGRGTNL* |
| Specificity: | SP3 - Sp3 transcription factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686O1631 antibody, anti-SPR-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |