| CatalogCode: | H00006670-M02 |
| ProductName: | SP3 Antibody |
| Product Description: | Mouse Monoclonal anti-SP3 (1B4) |
| Clone: | 1B4 |
| Clonality: | Monoclonal |
| Immunogen: | SP3 (NP_003102, 516 a.a. ~ 616 a.a) partial recombinant protein with GST tag. |
| Epitope: | GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL* ... |
| Specificity: | SP3 - Sp3 transcription factor |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp686O1631 antibody, anti-SPR-2 antibody |
| ProteinTarget: | SP3 - Sp3 transcription factor |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6670 |
| Gene_Symbol: | SP3 |
| Omim_ID: | 601804, |
order or more information: | company product webpage |
| request information: | |