| request information: |
|
| Catalog Code: | H00006666-M08 |
| Product Name: | SOX12 Antibody |
| Product Description: | Mouse Monoclonal anti-SOX12 (4A7) |
| Clone: | 4A7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6666 |
| Gene Symbol: | SOX12 |
| Omim ID: | 601947, |
| Immunogen: | SOX12 (NP_008874, 252 a.a. ~ 314 a.a) partial recombinant protein with GST tag. |
| Epitope: | LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SOX22 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |