| CatalogCode: | H00006662-M04 |
| ProductName: | SOX9 Antibody |
| Product Description: | Mouse Monoclonal anti-SOX9 (3F11) |
| Clone: | 3F11 |
| Clonality: | Monoclonal |
| Immunogen: | SOX9 (NP_000337, 400 a.a. ~ 510 a.a) partial recombinant protein with GST tag. |
| Epitope: | EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CMD1 antibody, anti-CMPD1 antibody, anti-SRA1 antibody |
| ProteinTarget: | SOX9 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6662 |
| Gene_Symbol: | SOX9 |
| Target_Reg: | SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal) |
| Omim_ID: | 114290, 608160, |
order or
more information: | company product webpage |
| request information: |
|