| request information: |
|
| Catalog Code: | H00006662-M01 |
| Product Name: | SOX9 Antibody |
| Product Description: | Mouse Monoclonal anti-SOX9 (2A2) |
| Clone: | 2A2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6662 |
| Gene Symbol: | SOX9 |
| Omim ID: | 114290, 608160, |
| Immunogen: | SOX9 (NP_000337, 400 a.a. ~ 510 a.a) partial recombinant protein with GST tag. |
| Epitope: | EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYT
PIADTSGVPSIPQTHSPQHWEQPVYTQLTRP* |
| Specificity: | SOX9 - SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CMD1 antibody, anti-CMPD1 antibody, anti-SRA1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |