| Catalog Code: | H00006648-B02 |
| Product Type: | Primary Antibody |
| Product Name: | SOD2 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 6648 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SOD2 - superoxide dismutase 2, mitochondrial, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and |
| Alternate Names: | anti-IPO-B antibody, anti-MNSOD antibody, anti-Mn-SOD antibody |
| Immunogen: | SOD2 (NP_001019636, 1 a.a. ~ 222 a.a) full-length human protein. |
| Epitope: | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |