| CatalogCode: | H00006623-B01 |
| ProductName: | SNCG Antibody |
| Product Description: | Mouse Polyclonal anti-SNCG - synuclein, gamma (breast cancer-specific protein 1), MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | SNCG (-, 1 a.a. ~ 127 a.a) full-length human protein. |
| Epitope: | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD ... |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | Synuclein-gamma is a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. High levels of SNCG have been identified in advanced breast carcinomas suggesting a correlation between overexpression of SNCG and breast tumor development. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-BCSG1 antibody, anti-SR antibody |
| ProteinTarget: | synuclein, gamma (breast cancer-specific protein 1) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 6623 |
| Gene_Symbol: | SNCG |
order or
more information: | company product webpage |
| request information: |
|