| request information: |
|
| Catalog Code: | H00006622-A02 |
| Product Name: | SNCA Antibody |
| Product Description: | Mouse Polyclonal anti-SNCA |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6622 |
| Gene Symbol: | SNCA |
| Omim ID: | 127750 163890 168601 605543 |
| Immunogen: | SNCA (NP_000336, 31 a.a. ~ 141 a.a) partial recombinant protein with GST tag. |
| Epitope: | GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ
EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA* |
| Specificity: | SNCA - synuclein, alpha (non A4 component of amyloid precursor) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-NACP antibody, anti-PARK1 antibody, anti-PARK4 antibody, anti-PD1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |