| request information: |
|
| Catalog Code: | H00006616-M01 |
| Product Name: | SNAP25 Antibody |
| Product Description: | Mouse Monoclonal anti-SNAP25 (4A3) |
| Clone: | 4A3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6616 |
| Gene Symbol: | SNAP25 |
| Omim ID: | 600322, |
| Immunogen: | SNAP25 (AAH10647, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
| Epitope: | RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQ
DGVVASQPARVVDEREQMAIS |
| Specificity: | SNAP25 - synaptosomal-associated protein, 25kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SNAP25 antibody, anti-synaptosomal-associated protein antibody, anti-25kDa antibody, anti-HGNC antibody, anti-11132 antibody, anti-FLJ23079 antibody, anti-SNAP antibody, anti-SNAP-25 antibody, anti-bA416N4.2 antibody, anti-dJ1068F16.2 antibody, anti-synaptosomal-associated protein 25 antbody antibody, anti-Official Symbol antibody, anti-SNAP25 antibody, anti-GenBank Accession Number(s) antibody, anti-NP_003072.2 antibody, anti-NP_570824.1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|