| request information: |
|
| Catalog Code: | H00006612-A01 |
| Product Name: | SUMO3 Antibody |
| Product Description: | Mouse Polyclonal anti-SUMO3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6612 |
| Gene Symbol: | SUMO3 |
| Omim ID: | 602231 |
| Immunogen: | SUMO3 (NP_008867, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMED
EDTIDVFQQQTGGVPESSLAGHSF* |
| Specificity: | SUMO3 - SMT3 suppressor of mif two 3 homolog 3 (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SMT3A antibody, anti-SMT3H1 antibody, anti-SUMO-3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |