| request information: |
|
| Catalog Code: | H00006611-M01 |
| Product Name: | SMS Antibody |
| Product Description: | Mouse Monoclonal anti-SMS (1G6) |
| Clone: | 1G6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6611 |
| Gene Symbol: | SMS |
| Omim ID: | 3.00105E+11 |
| Immunogen: | SMS (AAH09898, 1 a.a. ~ 367 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTW QDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKE EIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPT ADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDV NLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVK LKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLK |
| Specificity: | SMS - spermine synthase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene belongs to the spermidine/spermine synthases family. This gene encodes an ubiquitous enzyme of polyamine metabolism. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Spermine synthase antibody, anti-Spermidine aminopropyltransferase antibody, anti-SPMSY antibody, anti-MRSR antibody, anti-Spermidine aminopropyltransferase antibody, anti-SPMSY antibody, anti-SpS antibody, anti-SRS antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |