| request information: |
|
| Catalog Code: | H00006608-M16 |
| Product Name: | SMO Antibody |
| Product Description: | Mouse Monoclonal anti-SMO (4E9) |
| Clone: | 4E9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6608 |
| Gene Symbol: | SMO |
| Omim ID: | 601500, |
| Immunogen: | SMO (NP_005622, 653 a.a. ~ 787 a.a) full-length recombinant protein with GST tag. |
| Epitope: | NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWT
LVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Gx antibody, anti-SMOH antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |