ExactAntigen

Mouse Monoclonal anti-SMO (2F12) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006608-M10
ProductName: SMO Antibody
Product Description: Mouse Monoclonal anti-SMO (2F12)
Clone: 2F12
Clonality: Monoclonal
Immunogen: SMO (AAH09989, 56 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Epitope: GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-Gx antibody, anti-SMOH antibody
ProteinTarget: smoothened homolog (Drosophila)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6608
Gene_Symbol: SMO
Omim_ID: 601500,
more information: company product webpage
Also see:
see all human SMO antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about