| request information: |
|
| Catalog Code: | H00006603-M01 |
| Product Name: | SMARCD2 Antibody |
| Product Description: | Mouse Monoclonal anti-SMARCD2 (2F7) |
| Clone: | 2F7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6603 |
| Gene Symbol: | SMARCD2 |
| Omim ID: | 601736 |
| Immunogen: | SMARCD2 (NP_003068, 398 a.a. ~ 475 a.a) partial recombinant protein with GST tag. |
| Epitope: | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL* |
| Specificity: | SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BAF60B antibody, anti-CRACD2 antibody, anti-PRO2451 antibody, anti-Rsc6p antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |