| request information: |
|
| Catalog Code: | H00006590-M01 |
| Product Name: | SLPI Antibody |
| Product Description: | Mouse Monoclonal anti-SLPI (3C6) |
| Clone: | 3C6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6590 |
| Gene Symbol: | SLPI |
| Omim ID: | 107285, |
| Immunogen: | SLPI (NP_003055, 33 a.a. ~ 133 a.a) partial recombinant protein with GST tag. |
| Epitope: | GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQC
KRDLKCCMGMCGKSCVSPVKA* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ALK1 antibody, anti-ALP antibody, anti-BLPI antibody, anti-HUSI antibody, anti-HUSI-I antibody, anti-MPI antibody, anti-WAP4 antibody, anti-WFDC4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |