| CatalogCode: | H00006590-A01 |
| ProductName: | SLPI Antibody |
| Product Description: | Mouse Polyclonal anti-SLPI |
| Clonality: | Polyclonal |
| Immunogen: | SLPI (NP_003055, 33 a.a. ~ 133 a.a) partial recombinant protein with GST tag. |
| Epitope: | GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA* ... |
| Specificity: | SLPI - secretory leukocyte protease inhibitor (antileukoproteinase) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ALK1 antibody, anti-ALP antibody, anti-BLPI antibody, anti-HUSI antibody, anti-HUSI-I antibody, anti-MPI antibody, anti-WAP4 antibody, anti-WFDC4 antibody |
| ProteinTarget: | SLPI - secretory leukocyte protease inhibitor (antileukoproteinase) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6590 |
| Gene_Symbol: | SLPI |
| Omim_ID: | 107285 H00006590-M01 |
order or
more information: | company product webpage |
| request information: |
|