| request information: |
|
| Catalog Code: | H00006586-M04 |
| Product Name: | SLIT3 Antibody |
| Product Description: | Mouse Monoclonal anti-SLIT3 (3C5) |
| Clone: | 3C5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6586 |
| Gene Symbol: | SLIT3 |
| Omim ID: | 603745, |
| Immunogen: | SLIT3 (NP_003053, 1371 a.a. ~ 1471 a.a) partial recombinant protein with GST tag. |
| Epitope: | PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANAC SAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVV REVIRRQKGYASCATA* |
| Specificity: | SLIT3 - slit homolog 3 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Secreted |
| Background: | Slit3 (also known as multiple epidermal growth factor like domain 5 and Slit homolog 3 protein) is a Slit protein. The 'slit' gene has been shown to play a critical role in central nervous system midline formation. In addition to Slit3 there are two additional human 'slit' homologs, which are termed Slit1 and Slit2. Each SLIT gene encodes a putative secreted protein, which contains conserved protein-protein interaction domains including leucine-rich repeats and epidermal growth factor-like motifs, similar to those of the Drosophila protein. SLIT proteins may also participate in the formation and maintenance of the nervous and endocrine systems by protein-protein interactions. Slit3 is a secreted protein predominantly expressed in thyroid. Three isoforms have been reported for this product. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ10764 antibody, anti-KIAA0814 antibody, anti-MEGF 5 antibody, anti-MEGF5 antibody, anti-Multiple epidermal growth factor-like domains 5 antibody, anti-SLIL 2 antibody, anti-SLIL2 antibody, anti-SLIT 1 antibody, anti-Slit 2 antibody, anti-Slit 3 antibody, anti-Slit homolog 3 (Drosophila) antibody, anti-Slit homolog 3 antibody, anti-Slit homolog 3 protein antibody, anti-SLIT1 antibody, anti-Slit2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |