| CatalogCode: | | H00006586-A01 |
| ProductName: | | SLIT3 Antibody |
| Product Description: | | Mouse Polyclonal anti-SLIT3 |
| Clonality: | | Polyclonal |
| Immunogen: | | SLIT3 (NP_003053, 1371 a.a. ~ 1471 a.a) partial recombinant protein with GST tag. |
| Epitope: | | PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA* ... |
| Specificity: | | SLIT3 - slit homolog 3 (Drosophila) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml Ascites Mouse. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Ascites |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-MEGF5 antibody, anti-SLIL2 antibody, anti-SLIT1 antibody, anti-Slit-3 antibody, anti-slit2 antibody |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 6586 |
| Gene_Symbol: | | SLIT3 |
| Omim_ID: | | 603745, |
| more information: | | company product webpage |