| request information: |
|
| Catalog Code: | H00006581-A01 |
| Product Name: | solute carrier family 22 (extraneuronal monoamine transporter), member 3 Antibody |
| Product Description: | Mouse Polyclonal anti-solute carrier family 22 (extraneuronal monoamine transporter), member 3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6581 |
| Gene Symbol: | SLC22A3 |
| Omim ID: | 604842, |
| Immunogen: | SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag. |
| Epitope: | CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD* |
| Specificity: | solute carrier family 22 (extraneuronal monoamine transporter), member 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EMT antibody, anti-EMTH antibody, anti-OCT3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |