| request information: |
|
| Catalog Code: | H00006574-A01 |
| Product Name: | SLC20A1 Antibody |
| Product Description: | Mouse Polyclonal anti-SLC20A1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6574 |
| Gene Symbol: | SLC20A1 |
| Omim ID: | 137570 |
| Immunogen: | SLC20A1 (AAH19944, 1 a.a. ~ 680 a.a) full length recombinant protein with GST tag. |
| Epitope: | MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGA
KVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKI
VMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVG
CAVFCALIVWFFVCPRMK |
| Specificity: | SLC20A1 - solute carrier family 20 (phosphate transporter), member 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus (see MIM 182090). These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GLVR1 antibody, anti-Glvr-1 antibody, anti-PIT1 antibody, anti-PiT-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |