| request information: |
|
| Catalog Code: | H00006571-A01 |
| Product Name: | solute carrier family 18 (vesicular monoamine), member 2 Antibody |
| Product Description: | Mouse Polyclonal anti-solute carrier family 18 (vesicular monoamine), member 2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6571 |
| Gene Symbol: | SLC18A2 |
| Omim ID: | 193001, |
| Immunogen: | SLC18A2 (NP_003045, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. |
| Epitope: | HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQV
GLLFASKATVQLITNPFIGL* |
| Specificity: | solute carrier family 18 (vesicular monoamine), member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A1 (MIM 193002).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC120477 antibody, anti-MGC120478 antibody, anti-MGC26538 antibody, anti-SVAT antibody, anti-SVMT antibody, anti-VAT2 antibody, anti-VMAT2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |