| request information: |
|
| Catalog Code: | H00006556-M01 |
| Product Name: | SLC11A1 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC11A1 (2G2) |
| Clone: | 2G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6556 |
| Gene Symbol: | SLC11A1 |
| Omim ID: | 600266, 607948, |
| Immunogen: | SLC11A1 (NP_000569, 308 a.a. ~ 351 a.a) partial recombinant protein with GST tag. |
| Epitope: | QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGG V* |
| Specificity: | SLC11A1 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Membrane; Multi pass membrane protein. |
| Background: | This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-NRAMP1 antibody, anti-LSH antibody, anti-Natural resistance associated macrophage protein 1 antibody, anti-NRAMP 1 antibody, anti-NRAMP antibody, anti-PBC antibody, anti-SLC11A1 antibody, anti-Solute carrier family 11 (proton coupled divalent metal ion transporters) member 1 antibody, anti-solute carrier family 11 (sodium/phosphate symporters) member 1 antibody, anti-Solute carrier family 11 member 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |