ExactAntigen

Mouse Polyclonal anti-solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006531-A01
ProductName: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 Antibody
Product Description: Mouse Polyclonal anti-solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
Clonality: Polyclonal
Immunogen: SLC6A3 (NP_001035, 161 a.a. ~ 238 a.a) partial recombinant protein with GST tag.
Epitope: AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR* ...
Specificity: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested.
Background: The dopamine transporter (DAT1) mediates the active reuptake of dopamine from the synapse and is a principal regulator of dopaminergic neurotransmission. The DAT1 gene has been implicated in human disorders such as parkinsonism, Tourette syndrome, and substance abuse (Vandenbergh et al., 1992 [PubMed 1359373]).[supplied by OMIM]
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-DAT antibody, anti-DAT1 antibody
ProteinTarget: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6531
Gene_Symbol: SLC6A3
Omim_ID: 126455, 143465,
more information: company product webpage
Also see:
see all human dopamine transporter antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about