| CatalogCode: | | H00006531-A01 |
| ProductName: | | solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 Antibody |
| Product Description: | | Mouse Polyclonal anti-solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 |
| Clonality: | | Polyclonal |
| Immunogen: | | SLC6A3 (NP_001035, 161 a.a. ~ 238 a.a) partial recombinant protein with GST tag. |
| Epitope: | | AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR* ... |
| Specificity: | | solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera Other applications have not been tested. |
| Background: | | The dopamine transporter (DAT1) mediates the active reuptake of dopamine from the synapse and is a principal regulator of dopaminergic neurotransmission. The DAT1 gene has been implicated in human disorders such as parkinsonism, Tourette syndrome, and substance abuse (Vandenbergh et al., 1992 [PubMed 1359373]).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-DAT antibody, anti-DAT1 antibody |
| ProteinTarget: | | solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 6531 |
| Gene_Symbol: | | SLC6A3 |
| Omim_ID: | | 126455, 143465, |
| more information: | | company product webpage |