| request information: | |
| Catalog Code: | H00006524-M01 |
| Product Name: | SLC5A2 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC5A2 (3G8) |
| Clone: | 3G8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6524 |
| Gene Symbol: | SLC5A2 |
| Omim ID: | 182381, 233100, |
| Immunogen: | SLC5A2 (NP_003032, 228 a.a. ~ 278 a.a) partial recombinant protein with GST tag. |
| Epitope: | GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SGLT2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or more information: | company product webpage |