| CatalogCode: | H00006506-A01 |
| ProductName: | SLC1A2 Antibody |
| Product Description: | Mouse Polyclonal anti-SLC1A2 |
| Clonality: | Polyclonal |
| Immunogen: | SLC1A2 (NP_004162, 160 a.a. ~ 240 a.a) partial recombinant protein with GST tag. |
| Epitope: | DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG* ... |
| Specificity: | SLC1A2 - solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-EAAT2 antibody, anti-GLT-1 antibody |
| ProteinTarget: | SLC1A2 - solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6506 |
| Gene_Symbol: | SLC1A2 |
| Omim_ID: | 600300 H00006511-A01 |
order or
more information: | company product webpage |
| request information: |
|