ExactAntigen

SIPA1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006494-M01
Product Type:Primary Antibody
Product Name:SIPA1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6494
Host:Mouse
Clone:2B4
Product Description:Mouse Monoclonal anti-SIPA1 (2B4)
Species Summary:Hu
Background:The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell
Alternate Names:anti-GTPase-activating protein Spa-1 antibody, anti-MGC17037 antibody, anti-p130 SPA-1 antibody, anti-signal-induced proliferation-associated gene 1 antibody
Immunogen:SIPA1 (AAH10492, 933 a.a. ~ 1042 a.a) partial recombinant protein with GST tag.
Epitope:SEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 ml protein A purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SIPA1
Omim ID:602180,
see all human SIPA1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about