| request information: |
|
| Catalog Code: | H00006477-A01 |
| Product Name: | SIAH1 Antibody |
| Product Description: | Mouse Polyclonal anti-SIAH1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6477 |
| Gene Symbol: | SIAH1 |
| Omim ID: | 602212 |
| Immunogen: | SIAH1 (NP_003022, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPL
GSIRNLAMEKVANSVLFPCKYASSGCEITLP* |
| Specificity: | SIAH1 - seven in absentia homolog 1 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SIAH1 antibody, anti-seven in absentia homolog 1 (Drosophila) antibody, anti-Siah-1 antibody, anti-hSIAH1 antibody, anti-HUMSIAH antibody, anti-Siah-1a antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |