| request information: |
|
| Catalog Code: | H00006470-M01 |
| Product Name: | SHMT1 Antibody |
| Product Description: | Mouse Monoclonal anti-SHMT1 (4F9) |
| Clone: | 4F9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6470 |
| Gene Symbol: | SHMT1 |
| Omim ID: | 182144, |
| Immunogen: | SHMT1 (NP_004160, 374 a.a. ~ 483 a.a) partial recombinant protein with GST tag. |
| Epitope: | EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERL
AGDKYQAAVQALREEVESFASLFPLPGLPD* |
| Specificity: | SHMT1 - serine hydroxymethyltransferase 1 (soluble) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CSHMT antibody, anti-MGC15229 antibody, anti-MGC24556 antibody, anti-SHMT antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |