ExactAntigen

SGK Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006446-M05
Product Type:Primary Antibody
Product Name:SGK Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6446
Host:Mouse
Clone:3G8
Product Description:Mouse Monoclonal anti-SGK (3G8)
Species Summary:Hu
Background:This gene encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelli
Alternate Names:anti-serum/glucocorticoid regulated kinase antibody, anti-SGK1 antibody
Immunogen:SGK (AAH01263, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Epitope:MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN* ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 ml protein A purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SGK
Omim ID:602958,
see all human SGK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about