| Catalog Code: | H00006446-M05 |
| Product Type: | Primary Antibody |
| Product Name: | SGK Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6446 |
| Host: | Mouse |
| Clone: | 3G8 |
| Product Description: | Mouse Monoclonal anti-SGK (3G8) |
| Species Summary: | Hu |
| Background: | This gene encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelli |
| Alternate Names: | anti-serum/glucocorticoid regulated kinase antibody, anti-SGK1 antibody |
| Immunogen: | SGK (AAH01263, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 ml protein A purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | SGK |
| Omim ID: | 602958, |