| request information: | |
| Catalog Code: | H00006446-M01 |
| Product Name: | SGK Antibody |
| Product Description: | Mouse Monoclonal anti-SGK (4D7-G3) |
| Clone: | 4D7-G3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6446 |
| Gene Symbol: | SGK |
| Omim ID: | 602958 |
| Immunogen: | SGK (AAH01263, 1 a.a. ~ 432 a.a) full length recombinant protein with GST tag. |
| Epitope: | MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKI ANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQIN LGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAV KVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQT ADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCK |
| Specificity: | SGK - serum/glucocorticoid regulated kinase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation, and ELISA. |
| Localization: | Cytoplasmic and Nuclear (on phosphorylation). |
| Background: | This gene encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelling. Cellular hydration is a catabolic signal, stimulating glycogenolysis and proteolysis, and inhibiting protein and glycogen synthesis. This kinase has been shown to be important in activating certain potassium, sodium, and chloride channels. Expression of this gene in hepatocytes is stimulated by transforming growth factor-beta (TGF-beta) which participates in the pathophysiology of diabetic complications. Since both TGF-beta expression and SGK expression are elevated in diabetic nephropathy, this suggests an involvement of SGK in the development of this condition. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-SGK1 antibody, anti-Serum/glucocorticoid regulated kinase 1 antibody, anti-Serine/threonine protein kinase SGK antibody, anti-Serine/threonine protein kinase Sgk1 antibody, anti-Serum and glucocorticoid regulated kinase antibody, anti-Serum/glucocorticoid regulated kinase antibody, anti-SGK 1 antibody, anti-SGK antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |