| request information: |
|
| Catalog Code: | H00006441-M02 |
| Product Name: | SFTPD Antibody |
| Product Description: | Mouse Monoclonal anti-SFTPD (2A10) |
| Clone: | 2A10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6441 |
| Gene Symbol: | SFTPD |
| Omim ID: | 178635, |
| Immunogen: | SFTPD (AAH22318, 21 a.a. ~ 376 a.a) full length recombinant protein with GST tag. |
| Epitope: | AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPK
GDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPG
NTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNG
QSVGEKIFKTAGFVKPFT |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-COLEC7 antibody, anti-PSP-D antibody, anti-SFTP4 antibody, anti-SP-D antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |