| request information: |
|
| Catalog Code: | H00006430-B01 |
| Product Name: | SFRS5 Antibody |
| Product Description: | Mouse Polyclonal anti-SFRS5 - splicing factor, arginine/serine-rich 5, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6430 |
| Gene Symbol: | SFRS5 |
| Immunogen: | SFRS5 (AAH18823, 1 a.a. ~ 273 a.a) full-length human protein. |
| Epitope: | MSGCRVFIGRLNPAAREKGVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGG
RGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLK
NAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPE
KSQKRGSSSRSKSPASVD |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against immunizing recombinant protein, transfected lysate and tissue lysate for Western Blot. Has also been used for immunofluoresence, and immunohistochemistry (paraffin sections), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HRS antibody, anti-SRP40 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |