| request information: |
|
| Catalog Code: | H00006427-B01 |
| Product Name: | SFRS2 Antibody |
| Product Description: | Mouse Polyclonal anti-SFRS2 - splicing factor, arginine/serine-rich 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6427 |
| Gene Symbol: | SFRS2 |
| Immunogen: | SFRS2 (AAH66958, 1 a.a. ~ 180 a.a) full-length human protein. |
| Epitope: | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAD
PGVGAVPGLAADLATAARSLGPALVLDLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPGVLPQCPRGNPNPGRDRRV
PPSLLKRKERCPLKKMLRSPV* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-PR264 antibody, anti-SC-35 antibody, anti-SC35 antibody, anti-SRp30b antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |