| request information: |
|
| Catalog Code: | H00006426-B01 |
| Product Name: | SFRS1 Antibody |
| Product Description: | Mouse Polyclonal anti-SFRS1 - splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) |
| Clone: | splicing factor, arginine/serine-rich 1 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6426 |
| Gene Symbol: | SFRS1 |
| Immunogen: | SFRS1 (AAH10264, 1 a.a. ~ 249 a.a) full-length human protein. |
| Epitope: | MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDY
DGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTG
VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRY
SPRHSRSRSRT* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ASF antibody, anti-SF2 antibody, anti-SRp30a antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |