ExactAntigen

succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006391-M02
Product Name:succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa Antibody
Product Description:Mouse Monoclonal anti-succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa (3G7)
Clone:3G7
Clonality:Monoclonal
ListPrice:295
Gene ID:6391
Gene Symbol:SDHC
Omim ID:602413, 605373,
Immunogen:SDHC (AAH33626, 1 a.a. ~ 170 a.a) full length recombinant protein with GST tag.
Epitope:MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALS
AGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVL
TVLSSMGLAAM*
Specificity:succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:1X PBS pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CYB560 antibody, anti-CYBL antibody, anti-PGL3 antibody, anti-QPS1 antibody, anti-SDH3 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human SDHC antibodies


2008©ExactAntigen home | browse | about