| request information: |
|
| Catalog Code: | H00006391-M01 |
| Product Name: | SDHC Antibody |
| Product Description: | Mouse Monoclonal anti-SDHC (3E2) |
| Clone: | 3E2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6391 |
| Gene Symbol: | SDHC |
| Omim ID: | 602413, 605373, |
| Immunogen: | SDHC (AAH33626, 1 a.a. ~ 170 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFW NKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSL FGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMY HTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAA M* |
| Specificity: | SDHC - succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PGL3 antibody, anti-SDH3 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |