ExactAntigen

SDCBP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006386-M01
Product Type:Primary Antibody
Product Name:SDCBP Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6386
Host:Mouse
Clone:2C12
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-SDCBP (2C12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of tran
Alternate Names:anti-SDCBP antibody, anti-syndecan binding protein (syntenin) antibody, anti-MDA-9 antibody, anti-ST1 antibody, anti-SYCL antibody, anti-TACIP18 antibody, anti-melanoma differentiation associated protein-9 antibody, anti-pro-TGF-alpha cytoplasmic domain-i
Immunogen:SDCBP (NP_005616, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND* ...
Specificity:SDCBP - syndecan binding protein (syntenin)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is 5 (2 ug), 5 (10 ug), and 5 (25 ug).
Gene Symbol:SDCBP
Omim ID:602217,
see all human SDCBP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about